Structure of PDB 7lv9 Chain C Binding Site BS02

Receptor Information
>7lv9 Chain C (length=94) Species: 694581 (Marseillevirus marseillevirus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESKEGSRSSKAKLQISVARSERLLREHGGCSRVSEGAAVALAAAIEYFMG
EVLELAGNAARDSKKVRISVKHITLAIQNDAALFAVVGKGVFSG
Ligand information
>7lv9 Chain H (length=95) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atctgacacgtgcctggagactagggagtaatccccttggcggttaaaac
gcgggggagaatccgtacgtgcgtttaagcggtgctagagctgtc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lv9 The structure of a virus-encoded nucleosome.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		R111 R171
Binding residue
(residue number reindexed from 1)		R7 R67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7lv9, PDBe:7lv9, PDBj:7lv9
PDBsum7lv9
PubMed33927388
UniProtD2XB49

[Back to BioLiP]