Structure of PDB 7kux Chain C Binding Site BS02

Receptor Information

>7kux Chain C (length=80) Species: 3218 (Physcomitrium patens)

AHSVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKASQIASAPRTEDCVGC
KRCESACPTDFLSVRVYLGAETTRSMGLAY

Ligand information

• Ligand ID: SF4
• InChI: InChI=1S/4Fe.4S
• InChIKey: LJBDFODJNLIPKO-UHFFFAOYSA-N
• SMILES:
  OpenEye OEToolkits 2.0.7: [S]12[Fe]3[S]4[Fe]1[S]5[Fe]2[S]3[Fe]45
  CACTVS 3.385: S1[Fe]S[Fe]1.S2[Fe]S[Fe]2
• Formula: Fe4 S4
• Name: IRON/SULFUR CLUSTER
• PDB chain: 7kux Chain C Residue 1003

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7kux The structure of the Physcomitrium patens photosystem I reveals a unique Lhca2 paralogue replacing Lhca4.
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): C11 I12 G13 C14 T15 C17 C58 S64 V65
• Binding residue (residue number reindexed from 1): C10 I11 G12 C13 T14 C16 C57 S63 V64
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 1.97.1.12: photosystem I.

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009773 photosynthetic electron transport in photosystem I
• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009522 photosystem I
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:7kux, PDBe:7kux, PDBj:7kux
• PDBsum: 7kux
• PubMed: 35190662
• UniProt: Q6YXQ2|PSAC_PHYPA Photosystem I iron-sulfur center (Gene Name=psaC)