Structure of PDB 7k1k Chain C Binding Site BS02

Receptor Information

>7k1k Chain C (length=526) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIA
LVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQA
DFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLK
KCDISLQFFLPFSLGGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISL
EGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYK
SILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFR
YGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVF
AARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHN
YECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAK
KDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNM
LNPPAEVTTKSQIPLSKIKTLFPLIE

Ligand information

>7k1k Chain F (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgctctactgcttcgatatcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7k1k Structure of an activated DNA-PK and its implications for NHEJ.
Resolution	4.1 Å
Binding residue (original residue number in PDB)	R400 N402
Binding residue (residue number reindexed from 1)	R385 N387

Enzymatic activity

Enzyme Commision number

3.6.4.-

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003678	DNA helicase activity
GO:0003684	damaged DNA binding
GO:0003690	double-stranded DNA binding
GO:0003691	double-stranded telomeric DNA binding
GO:0003723	RNA binding
GO:0004386	helicase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008047	enzyme activator activity
GO:0008094	ATP-dependent activity, acting on DNA
GO:0016787	hydrolase activity
GO:0016887	ATP hydrolysis activity
GO:0031625	ubiquitin protein ligase binding
GO:0034511	U3 snoRNA binding
GO:0042162	telomeric DNA binding
GO:0044877	protein-containing complex binding
GO:0045027	DNA end binding
GO:0051575	5'-deoxyribose-5-phosphate lyase activity

	Biological Process
GO:0000723	telomere maintenance
GO:0000725	recombinational repair
GO:0002218	activation of innate immune response
GO:0006281	DNA repair
GO:0006302	double-strand break repair
GO:0006303	double-strand break repair via nonhomologous end joining
GO:0006310	DNA recombination
GO:0006974	DNA damage response
GO:0007004	telomere maintenance via telomerase
GO:0009410	response to xenobiotic stimulus
GO:0010558	negative regulation of macromolecule biosynthetic process
GO:0022008	neurogenesis
GO:0032204	regulation of telomere maintenance
GO:0032508	DNA duplex unwinding
GO:0034462	small-subunit processome assembly
GO:0042254	ribosome biogenesis
GO:0045087	innate immune response
GO:0045860	positive regulation of protein kinase activity
GO:0045892	negative regulation of DNA-templated transcription
GO:0048660	regulation of smooth muscle cell proliferation
GO:0050769	positive regulation of neurogenesis
GO:0060218	hematopoietic stem cell differentiation
GO:0070198	protein localization to chromosome, telomeric region
GO:0071398	cellular response to fatty acid
GO:0071425	hematopoietic stem cell proliferation
GO:0071475	cellular hyperosmotic salinity response
GO:0071480	cellular response to gamma radiation
GO:0071481	cellular response to X-ray
GO:1904430	negative regulation of t-circle formation
GO:1990830	cellular response to leukemia inhibitory factor

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0000783	nuclear telomere cap complex
GO:0005576	extracellular region
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005958	DNA-dependent protein kinase-DNA ligase 4 complex
GO:0016020	membrane
GO:0032040	small-subunit processome
GO:0032991	protein-containing complex
GO:0032993	protein-DNA complex
GO:0034774	secretory granule lumen
GO:0043564	Ku70:Ku80 complex
GO:0070418	DNA-dependent protein kinase complex
GO:0070419	nonhomologous end joining complex
GO:0090734	site of DNA damage
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7k1k, PDBe:7k1k, PDBj:7k1k
PDBsum	7k1k
PubMed	33385326
UniProt	P13010\|XRCC5_HUMAN X-ray repair cross-complementing protein 5 (Gene Name=XRCC5)

[Back to BioLiP]