Structure of PDB 7f3j Chain C Binding Site BS02

Receptor Information
>7f3j Chain C (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSV
GDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f3j Crystal structure of human YBX2 CSD in complex with m5C RNA in space group P1
Resolution1.95 Å
Binding residue
(original residue number in PDB)
K99 W100 N102 V103 R104 Y107 F109 D118 F120 E152 K153 Y173
Binding residue
(residue number reindexed from 1)
K11 W12 N14 V15 R16 Y19 F21 D30 F32 E64 K65 Y85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:7f3j, PDBe:7f3j, PDBj:7f3j
PDBsum7f3j
PubMed
UniProtQ9Y2T7|YBOX2_HUMAN Y-box-binding protein 2 (Gene Name=YBX2)

[Back to BioLiP]