Structure of PDB 7evr Chain C Binding Site BS02

Receptor Information
>7evr Chain C (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFD
SVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNP
Ligand information
>7evr Chain D (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YPPGYPMQAYVDPSNPNAGKVLLPTP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7evr Structural basis of the interaction between SETD2 methyltransferase and hnRNP L paralogs for governing co-transcriptional splicing.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y204 T213 I214 S250 L251 N252 D255 I256 Y257 S258
Binding residue
(residue number reindexed from 1)		Y15 T24 I25 S61 L62 N63 D66 I67 Y68 S69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7evr, PDBe:7evr, PDBj:7evr
PDBsum7evr
PubMed34750379
UniProtP14866|HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L (Gene Name=HNRNPL)

[Back to BioLiP]