Structure of PDB 7e9f Chain C Binding Site BS02

Receptor Information
>7e9f Chain C (length=101) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQN
L
Ligand information
>7e9f Chain J (length=126) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tctgacacgtgcctggagactagggagtaatccccttggcggttaaaacg
cgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgac
caattgagcggcctcggcaccgggat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e9f Nucleosome binding relinquishes the association of the BAH domain of Orc1 with Sir1
Resolution4.0 Å
Binding residue
(original residue number in PDB)
R18 G29 R33 R78
Binding residue
(residue number reindexed from 1)
R3 G14 R18 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7e9f, PDBe:7e9f, PDBj:7e9f
PDBsum7e9f
PubMed
UniProtP04912|H2A2_YEAST Histone H2A.2 (Gene Name=HTA2)

[Back to BioLiP]