Structure of PDB 7e8i Chain C Binding Site BS02

Receptor Information
>7e8i Chain C (length=108) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRAKACTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLP
NIQSVLLP
Ligand information
>7e8i Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatccga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e8i Structural insight into BRCA1-BARD1 complex recruitment to damaged chromatin.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
R11 T16 R17 R20 G28 R32 R42 R77
Binding residue
(residue number reindexed from 1)
R2 T7 R8 R11 G19 R23 R33 R68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:7e8i, PDBe:7e8i, PDBj:7e8i
PDBsum7e8i
PubMed34102105
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]