Structure of PDB 7d69 Chain C Binding Site BS02

Receptor Information
>7d69 Chain C (length=95) Species: 5741 (Giardia intestinalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSRSARAGISFPIGRIHRHLREGRYAERISSDAPVYLAAVLENVVAEVFR
EACNHRDKKSQKRIVPNHILTALRKDKELATIFANVTIREGGVAR
Ligand information
>7d69 Chain J (length=125) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacgc
acgtacggattccgtacgtgcgtttaagcggtgctagagctgtctacgac
caattgagcggcctcggcaccggga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d69 Cryo-EM structure of the nucleosome core particle containing Giardia lamblia histones.
Resolution3.57 Å
Binding residue
(original residue number in PDB)		K12 R26 R39 S41 S42 Q72 K73
Binding residue
(residue number reindexed from 1)		K1 R15 R28 S30 S31 Q61 K62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7d69, PDBe:7d69, PDBj:7d69
PDBsum7d69
PubMed34352093
UniProtA8BHS7

[Back to BioLiP]