Structure of PDB 7b4u Chain C Binding Site BS02

Receptor Information
>7b4u Chain C (length=128) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDLGKKLLEAARAGQDDEVRILMANGADVNASDADVGATPLHLAAWAGHL
EIVEVLLKTGADVNAVDIWGLTPLHLAAAVGHLEIVEVLLKHGADVNAQD
KFGKTPFDLAIDNGNEDIAEVLQKAAKL
Ligand information
>7b4u Chain B (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSIRIGPGQAFYAPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b4u Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		E20 A24
Binding residue
(residue number reindexed from 1)		E9 A13
External links