Structure of PDB 7azf Chain C Binding Site BS02

Receptor Information
>7azf Chain C (length=368) Species: 1444266 (Escherichia coli 2-427-07_S4_C3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTD
LEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERML
VRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAH
QDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRK
GVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVL
PKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPE
QEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQ
IEDAASQSAAYVVMPMRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7azf Iterative Structure-Based Optimization of Short Peptides Targeting the Bacterial Sliding Clamp.
Resolution1.93 Å
Binding residue
(original residue number in PDB)
T172 G174 H175 R176 P242 V344 M362 P363 R365
Binding residue
(residue number reindexed from 1)
T174 G176 H177 R178 P244 V346 M364 P365 R367
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0005515 protein binding
GO:0008408 3'-5' exonuclease activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006271 DNA strand elongation involved in DNA replication
GO:0006974 DNA damage response
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0032297 negative regulation of DNA-templated DNA replication initiation
GO:0042276 error-prone translesion synthesis
GO:0044787 bacterial-type DNA replication
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009360 DNA polymerase III complex
GO:0030894 replisome
GO:1990078 replication inhibiting complex
GO:1990085 Hda-beta clamp complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7azf, PDBe:7azf, PDBj:7azf
PDBsum7azf
PubMed34806883
UniProtP0A988|DPO3B_ECOLI Beta sliding clamp (Gene Name=dnaN)

[Back to BioLiP]