Structure of PDB 7a5h Chain C Binding Site BS02

Receptor Information
>7a5h Chain C (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PALLSLDENELEEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVKCHQTR
SVDQNRKLARKILQEKVDVFYNGENSPVHKEKREAAKKKQERKKRAKETL
EKKKLLKELWESSK
Ligand information
>7a5h Chain 24 (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaauguagcuuaaauuaucaaagcaaggcacugaaaaugccuagauga
gccucacagcuccauuaacacca
<<<<<<<.........................................<.
.........>..>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a5h Elongational stalling activates mitoribosome-associated quality control.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R99 Q103
Binding residue
(residue number reindexed from 1)		R50 Q54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003747 translation release factor activity
GO:0005515 protein binding
GO:0043023 ribosomal large subunit binding
Biological Process
GO:0006412 translation
GO:0006415 translational termination
GO:0072344 rescue of stalled ribosome
Cellular Component
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a5h, PDBe:7a5h, PDBj:7a5h
PDBsum7a5h
PubMed33243891
UniProtQ9H3J6|MTRFR_HUMAN Mitochondrial translation release factor in rescue (Gene Name=MTRFR)

[Back to BioLiP]