Structure of PDB 6yud Chain C Binding Site BS02

Receptor Information
>6yud Chain C (length=98) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMKFAVIDRKNFTLIHFEIEKPIKPEILKEIEIPSVDTRKGVVISGRGPI
WLHCFLAHKYAHTPFVAVYDPRLGAVVVQSHSELREGDVIDVVVEEIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yud Tetramerisation of the CRISPR ring nuclease Crn3/Csx3 facilitates cyclic oligoadenylate cleavage.
Resolution1.84 Å
Binding residue
(original residue number in PDB)		P21 I22 G45 R46 G47 P48 I49 Y68 P70 R71
Binding residue
(residue number reindexed from 1)		P22 I23 G46 R47 G48 P49 I50 Y69 P71 R72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6yud, PDBe:6yud, PDBj:6yud
PDBsum6yud
PubMed32597755
UniProtO28415|Y1864_ARCFU Uncharacterized protein AF_1864 (Gene Name=AF_1864)

[Back to BioLiP]