Structure of PDB 6y36 Chain C Binding Site BS02

Receptor Information

>6y36 Chain C (length=107) Species: 330879 (Aspergillus fumigatus Af293) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GTARDILTTYWQHIINHLESDNHDYKIHQLPLARIKKVMKADPEVKMISA
EAPILFAKGCDIFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDF
LIDIVPR

Ligand information

>6y36 Chain E (length=25) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaatccaccaatcaacgcctccgtg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6y36 Structural basis of HapE P88L -linked antifungal triazole resistance in Aspergillus fumigatus .
Resolution	2.3 Å
Binding residue (original residue number in PDB)	P88 L89 A90 R91 K94
Binding residue (residue number reindexed from 1)	P31 L32 A33 R34 K37

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0046982	protein heterodimerization activity

View graph for
Molecular Function

External links

PDB	RCSB:6y36, PDBe:6y36, PDBj:6y36
PDBsum	6y36
PubMed	32467317
UniProt	Q4WDM9

[Back to BioLiP]