Structure of PDB 6szv Chain C Binding Site BS02

Receptor Information
>6szv Chain C (length=250) Species: 1129347 (Influenza A virus (A/little yellow-shouldered bat/Guatemala/060/2010(H17N10))) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGMERIKELMEMVKNSRMREILTTTSVDHMAVIKKYTSGRQEKNPALRMK
WMMAMKYPISASSRIREMIPEKDEDGNTLWTNTKDAGSNRVLVSPNAVTW
WNRAGPVSDVVHYPRVYKMYFDRLERLTHGTFGPVKFYNQVKVRKRVDIN
PGHKDLTSREAQEVIMEVVFPNEVGARTLSSDAQLTITKEKKEELKNCKI
SPIMVAYMLERELVRRTRFLPIAGATSSTYVEVLHLTQGTCWEQQYTPGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6szv A Structure-Based Model for the Complete Transcription Cycle of Influenza Polymerase.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
P43 Y205
Binding residue
(residue number reindexed from 1)
P45 Y207
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006351 DNA-templated transcription
GO:0006370 7-methylguanosine mRNA capping
GO:0019083 viral transcription
GO:0039523 symbiont-mediated suppression of host mRNA transcription via inhibition of RNA polymerase II activity
GO:0075526 cap snatching
Cellular Component
GO:0033650 host cell mitochondrion
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6szv, PDBe:6szv, PDBj:6szv
PDBsum6szv
PubMed32304664
UniProtH6QM90

[Back to BioLiP]