Structure of PDB 6sy0 Chain C Binding Site BS02

Receptor Information
>6sy0 Chain C (length=104) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VILIDKIERCLVVEWYENNIRREQRISYKKYGNDKAKLRAKELIEKLKSG
ITFEQLYPDKGPPIVRVFENVGVYNLIRDRIEREWRRWSCKKVGNDEAQK
RADT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sy0 Structural and functional analysis of the Plasmodium falciparum SIP2 DNA binding domain
Resolution3.102 Å
Binding residue
(original residue number in PDB)		Q34 K39 K40 R49 K115 K116
Binding residue
(residue number reindexed from 1)		Q24 K29 K30 R39 K91 K92
Enzymatic activity
Enzyme Commision number ?
External links