Structure of PDB 6nnv Chain C Binding Site BS02

Receptor Information
>6nnv Chain C (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFTVTVPKDLYVVEYGSNMTIECKFPVELDLAALIVYWEMEDKNIIQFVH
GEEDLKTQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYG
GADYKRITVKVNAPYAAALHEHH
Ligand information
>6nnv Chain K (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FFKGDVFYGWYLCK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nnv Fragment-based screening of programmed death ligand 1 (PD-L1).
Resolution1.92 Å
Binding residue
(original residue number in PDB)		I54 Y56 E58 D61 M115 I116 S117 A121 D122 Y123
Binding residue
(residue number reindexed from 1)		I35 Y37 E39 D42 M96 I97 S98 A102 D103 Y104
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6nnv, PDBe:6nnv, PDBj:6nnv
PDBsum6nnv
PubMed30728114
UniProtQ9NZQ7|PD1L1_HUMAN Programmed cell death 1 ligand 1 (Gene Name=CD274)

[Back to BioLiP]