Structure of PDB 6m4d Chain C Binding Site BS02

Receptor Information
>6m4d Chain C (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEV
LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAG
Ligand information
>6m4d Chain J (length=125) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atatctgacacgtgcctggagactagggagtaatccccttggcggttaaa
acgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctac
gaccaattgagcggcctcggcaccg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m4d Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
Resolution4.4 Å
Binding residue
(original residue number in PDB)		A16 V17 S18 R19 G30 R31 R34
Binding residue
(residue number reindexed from 1)		A1 V2 S3 R4 G15 R16 R19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6m4d, PDBe:6m4d, PDBj:6m4d
PDBsum6m4d
PubMed33073403
UniProtQ71UI9|H2AV_HUMAN Histone H2A.V (Gene Name=H2AZ2)

[Back to BioLiP]