Structure of PDB 6m3d Chain C Binding Site BS02

Receptor Information
>6m3d Chain C (length=108) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKAA
RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNK
AAKIKKSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m3d Structural basis for designing an array of engrailed homeodomains.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		R90 R92 K137
Binding residue
(residue number reindexed from 1)		R51 R53 K98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6m3d, PDBe:6m3d, PDBj:6m3d
PDBsum6m3d
PubMed32876058
UniProtP02836|HMEN_DROME Segmentation polarity homeobox protein engrailed (Gene Name=en)

[Back to BioLiP]