Structure of PDB 6l9h Chain C Binding Site BS02

Receptor Information
>6l9h Chain C (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILEL
AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVL
LPK
Ligand information
>6l9h Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaccctaaccctaaccctaaccctaaccctaaccctaaccctaaccct
aaccctaaccctaaccctaaccctaaccctaaccctaaccctaaccctaa
ccctaaccctaaccctaaccctaaccctaaccctaaccctaagat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l9h The human telomeric nucleosome displays distinct structural and dynamic properties.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R42 V43 G44 A45 K75 T76 R77
Binding residue
(residue number reindexed from 1)		R27 V28 G29 A30 K60 T61 R62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6l9h, PDBe:6l9h, PDBj:6l9h
PDBsum6l9h
PubMed
UniProtP04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)

[Back to BioLiP]