Structure of PDB 6khy Chain C Binding Site BS02

Receptor Information
>6khy Chain C (length=299) Species: 561443 (African swine fever virus tick/South Africa/Pretoriuskop Pr4/1996) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGGMFGAFVSHRLWSDSGCTTTCITNSIANYVAFGEQIGFPFKSAQVFIA
GPRKAVINIQEDDKVELLKMIVKHNLWVVAHGTYLDVPWSRRSAFVTHFI
QQELLICKEVGIKGLVLHLGAVEPELIVEGLKKIKPVEGVVIYLETPHNK
HHTYKYSTMEQIKELFLRIRNTRLKQIGLCIDTAHIWSSGVNISSYNDAG
QWLRSLENIHSVIPPSHIMFHLNDAATECGSGIDRHASLFEGMIWKSYSH
KIKQSGLYCFVEYITRHQCPAILERNLGSSMQLQTALTAEFTTLKSLLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6khy A unique DNA-binding mode of African swine fever virus AP endonuclease.
Resolution3.008 Å
Binding residue
(original residue number in PDB)		Y81 L82 V84 A118 N146 K147 H148 H149
Binding residue
(residue number reindexed from 1)		Y84 L85 V87 A121 N149 K150 H151 H152
Enzymatic activity
Enzyme Commision number 3.1.21.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0004519 endonuclease activity
GO:0004527 exonuclease activity
GO:0008081 phosphoric diester hydrolase activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
Cellular Component
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6khy, PDBe:6khy, PDBj:6khy
PDBsum6khy
PubMed32194979
UniProtP0C9C6|APE_ASFP4 Probable AP endonuclease (Gene Name=Pret-146)

[Back to BioLiP]