Structure of PDB 6k1j Chain C Binding Site BS02

Receptor Information
>6k1j Chain C (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEI
LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQ
AVLLPKKTSATV
Ligand information
>6k1j Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgattcagctgaacatgccttttgatggagc
agtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6k1j PARP1 exhibits enhanced association and catalytic efficiency with gamma H2A.X-nucleosome.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		R29 R35 R42 K75 T76 R77
Binding residue
(residue number reindexed from 1)		R17 R23 R30 K63 T64 R65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0042393 histone binding
GO:0046982 protein heterodimerization activity
GO:0140463 chromatin-protein adaptor activity
Biological Process
GO:0000077 DNA damage checkpoint signaling
GO:0000724 double-strand break repair via homologous recombination
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0006310 DNA recombination
GO:0006334 nucleosome assembly
GO:0006974 DNA damage response
GO:0007283 spermatogenesis
GO:0010212 response to ionizing radiation
GO:0021987 cerebral cortex development
GO:0031507 heterochromatin formation
GO:0045739 positive regulation of DNA repair
GO:0051321 meiotic cell cycle
GO:0071480 cellular response to gamma radiation
GO:0090398 cellular senescence
GO:1990166 protein localization to site of double-strand break
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0000794 condensed nuclear chromosome
GO:0001673 male germ cell nucleus
GO:0001741 XY body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005657 replication fork
GO:0005694 chromosome
GO:0005813 centrosome
GO:0016607 nuclear speck
GO:0035861 site of double-strand break
GO:0070062 extracellular exosome
GO:0090734 site of DNA damage

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6k1j, PDBe:6k1j, PDBj:6k1j
PDBsum6k1j
PubMed31848352
UniProtP16104|H2AX_HUMAN Histone H2AX (Gene Name=H2AX)

[Back to BioLiP]