Structure of PDB 6jxd Chain C Binding Site BS02

Receptor Information
>6jxd Chain C (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNI
QAVLLPK
Ligand information
>6jxd Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
catatatgccggtctcacacgtgcctggagactagtaagcgcttctagtg
gcggttaaaacgcggtagacagcgcgtacgtgcgtttaagcggtgctaga
gctgtctacgaccaattgagcggcctcggcaccgggatatatggtac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jxd PARP1 exhibits enhanced association and catalytic efficiency with gamma H2A.X-nucleosome.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R29 R42 V43 G44 A45 K75 T76 R77
Binding residue
(residue number reindexed from 1)		R18 R31 V32 G33 A34 K64 T65 R66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6jxd, PDBe:6jxd, PDBj:6jxd
PDBsum6jxd
PubMed31848352
UniProtP04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)

[Back to BioLiP]