Structure of PDB 6jdg Chain C Binding Site BS02

Receptor Information
>6jdg Chain C (length=97) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGVNKVILVGNVGGDPETRYMPNGNAVTNITLATSESERTEWHRVVFFGR
LAEIAGEYLRKGSQVYVEGSLRTRKWQGDRYTTEIVVDINGNMQLLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jdg Complexed crystal structure of SSB reveals a novel single-stranded DNA binding mode (SSB)3:1: Phe60 is not crucial for defining binding paths.
Resolution2.388 Å
Binding residue
(original residue number in PDB)		K7 I105 N106
Binding residue
(residue number reindexed from 1)		K5 I89 N90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6jdg, PDBe:6jdg, PDBj:6jdg
PDBsum6jdg
PubMed31604524
UniProtP40947|SSB_PSEAE Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]