Structure of PDB 6htu Chain C Binding Site BS02

Receptor Information

>6htu Chain C (length=65) Species: 9606 (Homo sapiens)

GINPISRLAQIQQAKEPEYTLLTPRRREFVMQVKVGNHTAEGTGTNKKVA
KRNAAENMLEILGFK

Ligand information

>6htu Chain F (length=19)

gaggcaguuucugguacuc

...................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6htu The crystal structure of Staufen1 in complex with a physiological RNA sheds light on substrate selectivity.
• Resolution: 2.888 Å
• Binding residue (original residue number in PDB): N286 I288 S289
• Binding residue (residue number reindexed from 1): N3 I5 S6
• Binding affinity: PDBbind-CN: Kd=14nM

External links

• PDB: RCSB:6htu, PDBe:6htu, PDBj:6htu
• PDBsum: 6htu
• PubMed: 30456389
• UniProt: O95793|STAU1_HUMAN Double-stranded RNA-binding protein Staufen homolog 1 (Gene Name=STAU1)