Structure of PDB 6hct Chain C Binding Site BS02

Receptor Information
>6hct Chain C (length=117) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIA
EDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINE
GELRKELGSLVEKIKGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hct The role of RNA structure in translational regulation by L7Ae protein in archaea.
Resolution3.091 Å
Binding residue
(original residue number in PDB)		N33 E34
Binding residue
(residue number reindexed from 1)		N33 E34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hct, PDBe:6hct, PDBj:6hct
PDBsum6hct
PubMed30327333
UniProtO29494|RL7A_ARCFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]