Structure of PDB 6gb7 Chain C Binding Site BS02

Receptor Information
>6gb7 Chain C (length=273) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGLLRTDSPKAHVTHHPRSKGEVTLRC
WALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGK
EQNYTCRVYHEGLPEPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gb7 Successive crystal structure snapshots suggest the basis for MHC class I peptide loading and editing by tapasin.
Resolution2.15 Å
Binding residue
(original residue number in PDB)
W73 S77 N80 Y84 Y123 I142 T143 K146 W147
Binding residue
(residue number reindexed from 1)
W73 S77 N80 Y84 Y123 I142 T143 K146 W147
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0001913 T cell mediated cytotoxicity
GO:0001916 positive regulation of T cell mediated cytotoxicity
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
GO:0002485 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
GO:0006955 immune response
GO:0010977 negative regulation of neuron projection development
GO:0019882 antigen processing and presentation
Cellular Component
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0042612 MHC class I protein complex
GO:0098553 lumenal side of endoplasmic reticulum membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6gb7, PDBe:6gb7, PDBj:6gb7
PDBsum6gb7
PubMed30808808
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]