Structure of PDB 6bz3 Chain C Binding Site BS02

Receptor Information
>6bz3 Chain C (length=125) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDET
IPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQML
TAAHALAVDAKNLLDVIDQARLKML
Ligand information
>6bz3 Chain D (length=19) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDLSEQMASLEGLMKQLNA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bz3 The binding of DCC-P3 motif and FAK-FAT domain mediates the initial step of netrin-1/DCC signaling for axon attraction.
Resolution2.497 Å
Binding residue
(original residue number in PDB)		K1018 L1021 H1025
Binding residue
(residue number reindexed from 1)		K97 L100 H104
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Molecular Function
GO:0004713 protein tyrosine kinase activity
Biological Process
GO:0006468 protein phosphorylation
GO:0007172 signal complex assembly
Cellular Component
GO:0005925 focal adhesion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bz3, PDBe:6bz3, PDBj:6bz3
PDBsum6bz3
PubMed29479476
UniProtP34152|FAK1_MOUSE Focal adhesion kinase 1 (Gene Name=Ptk2)

[Back to BioLiP]