Structure of PDB 6asd Chain C Binding Site BS02

Receptor Information

>6asd Chain C (length=45) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GKRKRCGVCEPCQQKTNCGECTYCKNRKNSHQICKKRKCEELKKK

Ligand information

>6asd Chain B (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccaccggtggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6asd DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
Resolution	1.85 Å
Binding residue (original residue number in PDB)	K587 R588 H616 K623 L627
Binding residue (residue number reindexed from 1)	K2 R3 H31 K38 L42
Binding affinity	PDBbind-CN: Kd=2.4uM

Enzymatic activity

Enzyme Commision number

1.14.11.80: methylcytosine dioxygenase.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0008270	zinc ion binding

View graph for
Molecular Function

External links

PDB	RCSB:6asd, PDBe:6asd, PDBj:6asd
PDBsum	6asd
PubMed	29276034
UniProt	Q8NFU7\|TET1_HUMAN Methylcytosine dioxygenase TET1 (Gene Name=TET1)

[Back to BioLiP]