Structure of PDB 6ako Chain C Binding Site BS02

Receptor Information
>6ako Chain C (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNS
IRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ako Structural basis for DNA recognition by FOXC2.
Resolution2.396 Å
Binding residue
(original residue number in PDB)		L95 R121 H122 S125 K132 K142 S144 W146 R163 R166
Binding residue
(residue number reindexed from 1)		L26 R52 H53 S56 K63 K73 S75 W77 R94 R97
Binding affinityPDBbind-CN: Kd=0.79uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ako, PDBe:6ako, PDBj:6ako
PDBsum6ako
PubMed30722065
UniProtQ99958|FOXC2_HUMAN Forkhead box protein C2 (Gene Name=FOXC2)

[Back to BioLiP]