Structure of PDB 5zpw Chain C Binding Site BS02

Receptor Information
>5zpw Chain C (length=35) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLLRAIEAQQHLLQLTVWGIKQLQARLLAVERYLK
Ligand information
>5zpw Chain F (length=24) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MTWEEWDKKIEKYTKKIEKLIKKS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zpw Generation of a long-acting fusion inhibitor against HIV-1.
Resolution2.199 Å
Binding residue
(original residue number in PDB)
N554 Q562 H564 L565 L568 W571
Binding residue
(residue number reindexed from 1)
N1 Q9 H11 L12 L15 W18
Enzymatic activity
Enzyme Commision number ?
External links