Structure of PDB 5z7i Chain C Binding Site BS02

Receptor Information
>5z7i Chain C (length=45) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSWTDERVSTLKKLWLDGLSASQIAKQLGGVTRNAVIGKVHRLGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z7i Structural insights into the unique mechanism of transcription activation by Caulobacter crescentus GcrA.
Resolution1.601 Å
Binding residue
(original residue number in PDB)		Q23 K26
Binding residue
(residue number reindexed from 1)		Q23 K26
Enzymatic activity
Enzyme Commision number ?
External links