Structure of PDB 5z30 Chain C Binding Site BS02

Receptor Information
>5z30 Chain C (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAE
VLELAGNASKDLKVKCITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIH
KSLIG
Ligand information
>5z30 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z30 Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
R31 R45 V46 G47 V78 K79 C80
Binding residue
(residue number reindexed from 1)
R17 R31 V32 G33 V64 K65 C66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031490 chromatin DNA binding
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0071392 cellular response to estradiol stimulus
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0000792 heterochromatin
GO:0001740 Barr body
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5z30, PDBe:5z30, PDBj:5z30
PDBsum5z30
PubMed30053102
UniProtP0C0S5|H2AZ_HUMAN Histone H2A.Z (Gene Name=H2AZ1)

[Back to BioLiP]