Structure of PDB 5yzz Chain C Binding Site BS02

Receptor Information
>5yzz Chain C (length=111) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LNLNIVPLFEKTLSASDAGRIGRLVLPKACAEAYFPPISQSEGIPLKIQD
VRGREWTFQFRYWPNNNSRMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGG
KLIMGSRKAAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yzz Structural insight into the role of VAL1 B3 domain for targeting to FLC locus in Arabidopsis thaliana.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		K297 S300 A301 S302 V311 P313 K314 N351 M356
Binding residue
(residue number reindexed from 1)		K11 S14 A15 S16 V25 P27 K28 N65 M70
Binding affinityPDBbind-CN: Kd=6.13uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5yzz, PDBe:5yzz, PDBj:5yzz
PDBsum5yzz
PubMed29733847
UniProtQ8W4L5|VAL1_ARATH B3 domain-containing transcription repressor VAL1 (Gene Name=VAL1)

[Back to BioLiP]