Structure of PDB 5yj3 Chain C Binding Site BS02

Receptor Information
>5yj3 Chain C (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHME
IHDRVENYNPRQRKLRNLII
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yj3 The 11th C2H2 zinc finger and an adjacent C-terminal arm are responsible for TZAP recognition of telomeric DNA.
Resolution2.845 Å
Binding residue
(original residue number in PDB)		R576 Y585 H592 R595 H596 I599 Y606 R611 L613 R614
Binding residue
(residue number reindexed from 1)		R28 Y37 H44 R47 H48 I51 Y58 R63 L65 R66
Binding affinityPDBbind-CN: Kd=0.17uM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5yj3, PDBe:5yj3, PDBj:5yj3
PDBsum5yj3
PubMed29134956
UniProtP10074|TZAP_HUMAN Telomere zinc finger-associated protein (Gene Name=ZBTB48)

[Back to BioLiP]