Structure of PDB 5xtm Chain C Binding Site BS02

Receptor Information
>5xtm Chain C (length=123) Species: 70601 (Pyrococcus horikoshii OT3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKL
VIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVA
IIEPGKARDLVEEIAMKVRELMK
Ligand information
>5xtm Chain D (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguaugggaugaaagcggugaagggaaaccgaguuaaccccuaagcc
<<<..<<<.....<<<......<<....>>..>>>...>>>...>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xtm Crystal structures of the archaeal RNase P protein Rpp38 in complex with RNA fragments containing a K-turn motif.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		K35 G36 T37 N38 E39 K42 R46 V58 D59 K84 I93 E94 V95 A96 A97 A98
Binding residue
(residue number reindexed from 1)		K34 G35 T36 N37 E38 K41 R45 V57 D58 K83 I92 E93 V94 A95 A96 A97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xtm, PDBe:5xtm, PDBj:5xtm
PDBsum5xtm
PubMed29372908
UniProtP62009|RL7A_PYRHO Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]