Structure of PDB 5we2 Chain C Binding Site BS02

Receptor Information
>5we2 Chain C (length=229) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCHE
KMPIFMDIAFIEYCFNLSLDPFQNLPITQTQPDSQQILWEYSLISNALER
LENIELERQNCMRENKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDH
INFTKFLQDWGSHNEKEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNS
VLSRYIQCTKLQLEVFCDYDFKQREIVKM
Ligand information
>5we2 Chain F (length=6) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GEDLEI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5we2 Structural Basis for Shelterin Bridge Assembly.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K139 E181 M207
Binding residue
(residue number reindexed from 1)		K125 E167 M193
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0000723 telomere maintenance
GO:0016233 telomere capping
GO:0032200 telomere organization
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070187 shelterin complex
GO:0140445 chromosome, telomeric repeat region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5we2, PDBe:5we2, PDBj:5we2
PDBsum5we2
PubMed29149597
UniProtO13852|POZ1_SCHPO Protection of telomeres protein poz1 (Gene Name=poz1)

[Back to BioLiP]