Structure of PDB 5vxn Chain C Binding Site BS02

Receptor Information
>5vxn Chain C (length=203) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAH
VLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDL
DIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAKRLSPKES
EVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLS
SVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vxn Structural Basis for DNA Recognition by the Two-Component Response Regulator RcsB.
Resolution3.375 Å
Binding residue
(original residue number in PDB)		L167 T169 S183 K186 K187
Binding residue
(residue number reindexed from 1)		L161 T163 S177 K180 K181
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0031346 positive regulation of cell projection organization
GO:0043470 regulation of carbohydrate catabolic process
GO:0044011 single-species biofilm formation on inanimate substrate
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0046677 response to antibiotic
GO:1901913 regulation of capsule organization
GO:1902021 regulation of bacterial-type flagellum-dependent cell motility
GO:1990451 cellular stress response to acidic pH
Cellular Component
GO:0005667 transcription regulator complex
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vxn, PDBe:5vxn, PDBj:5vxn
PDBsum5vxn
PubMed29487239
UniProtP0DMC7|RCSB_ECOLI Transcriptional regulatory protein RcsB (Gene Name=rcsB)

[Back to BioLiP]