Structure of PDB 5vwz Chain C Binding Site BS02

Receptor Information
>5vwz Chain C (length=164) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMSEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSST
MGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARW
IAQRGGWVAALNLG
Ligand information
>5vwz Chain D (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DMRPEIWIAQELRRIGDEFNAYYARR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vwz Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design.
Resolution1.622 Å
Binding residue
(original residue number in PDB)		R42 I81 I85 N86 Y89 E92 M96 L100 Y110 I114 S117 L118 S121 N124 G126 R127 A130 F134 R137 G184
Binding residue
(residue number reindexed from 1)		R22 I61 I65 N66 Y69 E72 M76 L80 Y90 I94 S97 L98 S101 N104 G106 R107 A110 F114 R117 G164
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vwz, PDBe:5vwz, PDBj:5vwz
PDBsum5vwz
PubMed29149594
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]