Structure of PDB 5vay Chain C Binding Site BS02

Receptor Information
>5vay Chain C (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YDNREIVMKYIHYKLSQRGYEWDASEVVHLTLRQAGDDFSRRYRRDFAEM
SSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE
MSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP
Ligand information
>5vay Chain G (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GDMENLSRRLKVTGDLFDIMS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vay Bcl-2 complex with Beclin 1 pT108 BH3 domain
Resolution1.804 Å
Binding residue
(original residue number in PDB)		A100 F104 R107 Y108 F112 M115 Q118 H120 V133 E136 L137 D140 N143 G145 R146 F153 Y202
Binding residue
(residue number reindexed from 1)		A35 F39 R42 Y43 F47 M50 Q53 H55 V68 E71 L72 D75 N78 G80 R81 F88 Y137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vay, PDBe:5vay, PDBj:5vay
PDBsum5vay
PubMed
UniProtP10415|BCL2_HUMAN Apoptosis regulator Bcl-2 (Gene Name=BCL2);
Q07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]