Structure of PDB 5u1q Chain C Binding Site BS02

Receptor Information
>5u1q Chain C (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLC
HLQKVKHYLILPSEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLL
RHCCT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u1q Discovery, Development, and Cellular Delivery of Potent and Selective Bicyclic Peptide Inhibitors of Grb7 Cancer Target.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		D496 Q499
Binding residue
(residue number reindexed from 1)		D73 Q76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5u1q, PDBe:5u1q, PDBj:5u1q
PDBsum5u1q
PubMed29083893
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]