Structure of PDB 5ob2 Chain C Binding Site BS02

Receptor Information
>5ob2 Chain C (length=52) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFVALYDYESRTTTDLSFKKGERLQIVNGDWWLAHSLTTGRTGYIPSNYV
AP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ob2 Crystal structure of the c-Src-SH3 domain E97T mutant in complex with the high affinity peptide APP12
Resolution1.8 Å
Binding residue
(original residue number in PDB)
Y90 R95 T96 D99 G116 D117 W118 N135 Y136
Binding residue
(residue number reindexed from 1)
Y6 R11 T12 D15 G29 D30 W31 N48 Y49
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:5ob2, PDBe:5ob2, PDBj:5ob2
PDBsum5ob2
PubMed
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]