Structure of PDB 5n9g Chain C Binding Site BS02

Receptor Information
>5n9g Chain C (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSTTTYSSFRKNYYSKPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARI
EIKNKFKREEKTNGWRIDKAFQEKRPFDFDFFAHLLQKVLAEEEKRK
Ligand information
>5n9g Chain E (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttgaagggcttaaaataggtgtgac
.........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n9g Molecular mechanisms of Bdp1 in TFIIIB assembly and RNA polymerase III transcription initiation.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		F294 S300 P302 W303 N339 R343
Binding residue
(residue number reindexed from 1)		F9 S15 P17 W18 N54 R58
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5n9g, PDBe:5n9g, PDBj:5n9g
PDBsum5n9g
PubMed28743884
UniProtA6H8Y1|BDP1_HUMAN Transcription factor TFIIIB component B'' homolog (Gene Name=BDP1)

[Back to BioLiP]