Structure of PDB 5n8e Chain C Binding Site BS02

Receptor Information
>5n8e Chain C (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAP
ATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGT
TEANAWKSTLVGHDTFTKVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n8e Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target.
Resolution1.1 Å
Binding residue
(original residue number in PDB)		W120 K121 T123
Binding residue
(residue number reindexed from 1)		W106 K107 T109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5n8e, PDBe:5n8e, PDBj:5n8e
PDBsum5n8e
PubMed28935886
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]