Structure of PDB 5m0i Chain C Binding Site BS02

Receptor Information

>5m0i Chain C (length=240) Species: 285006 (Saccharomyces cerevisiae RM11-1a) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LGSDIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFER
TTLIKFVKKLRFYNDSVLSYNASEFINEGKDPEADSFDKVILPIASMFVK
SVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFS
QWMIESLRIGSNLLDLEVVQFAIKSADEDGTNIGETDNIFLQEILPVNSE
EEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGKLK

Ligand information

>5m0i Chain F (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gauaacugaaucgaaagacauuaucacg

<<<<......<<....>>...>>>>...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5m0i Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
Resolution	2.41 Å
Binding residue (original residue number in PDB)	N36 K37 S40 H41 R43 R49 R52 I56 K60 R63 H238 G242 K243 L244
Binding residue (residue number reindexed from 1)	N34 K35 S38 H39 R41 R47 R50 I54 K58 R61 H233 G237 K238 L239

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:0008289	lipid binding
GO:1990825	sequence-specific mRNA binding

	Biological Process
GO:0007533	mating type switching
GO:0008298	intracellular mRNA localization
GO:0051028	mRNA transport

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005934	cellular bud tip

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5m0i, PDBe:5m0i, PDBj:5m0i
PDBsum	5m0i
PubMed	28092367
UniProt	P36068\|SHE2_YEAST SWI5-dependent HO expression protein 2 (Gene Name=SHE2)

[Back to BioLiP]