Structure of PDB 5lhz Chain C Binding Site BS02

Receptor Information
>5lhz Chain C (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTT
RYGENEKLPDYIKQKLQCLSSILLMFS
Ligand information
>5lhz Chain F (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QDRQLRLLQAQIQRLLEAQSLM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lhz A key centriole assembly interaction interface between human PLK4 and STIL appears to not be conserved in flies.
Resolution2.51 Å
Binding residue
(original residue number in PDB)
Q901 Q920 A921 V923 E942 K943 L944 Q953
Binding residue
(residue number reindexed from 1)
Q15 Q34 A35 V37 E56 K57 L58 Q67
Enzymatic activity
Enzyme Commision number 2.7.11.21: polo kinase.
External links
PDB RCSB:5lhz, PDBe:5lhz, PDBj:5lhz
PDBsum5lhz
PubMed28202467
UniProtO00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 (Gene Name=PLK4)

[Back to BioLiP]