Structure of PDB 5k5o Chain C Binding Site BS02

Receptor Information
>5k5o Chain C (length=88) Species: 84600 (Sulfolobus sp. NOB8H2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAE
GYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k5o Structures of archaeal DNA segregation machinery reveal bacterial and eukaryotic linkages.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
S5 T6
Binding residue
(residue number reindexed from 1)
S1 T2
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5k5o, PDBe:5k5o, PDBj:5k5o
PDBsum5k5o
PubMed26339031
UniProtO93706

[Back to BioLiP]