Structure of PDB 5itu Chain C Binding Site BS02

Receptor Information
>5itu Chain C (length=271) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEGPELHLASQFVNEACRALVFGCEKSSVSRNPEVPFESSAYRISASARG
KELRLILSPLPGAPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTA
PPGPRLALCFVDIRRFGRWDLGKWQPGRGPCVLQEYQQFRENVLRNLDKA
FDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQTLSQ
KITKLQNPDLLELCHSVPKEVVQLGGKYGESGEEDFAAFRAWLRCYGMPG
MSSLQDGRTIWFQGDPGPLAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5itu Tautomerization-dependent recognition and excision of oxidation damage in base-excision DNA repair
Resolution2.41 Å
Binding residue
(original residue number in PDB)		R34 H96 I117 R118 R119 F120
Binding residue
(residue number reindexed from 1)		R31 H92 I113 R114 R115 F116
Enzymatic activity
Enzyme Commision number 3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0016829 lyase activity
GO:0019104 DNA N-glycosylase activity
GO:0140078 class I DNA-(apurinic or apyrimidinic site) endonuclease activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006287 base-excision repair, gap-filling
GO:0006979 response to oxidative stress
GO:0032074 negative regulation of nuclease activity
GO:0045008 depyrimidination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5itu, PDBe:5itu, PDBj:5itu
PDBsum5itu
PubMed27354518
UniProtQ96FI4|NEIL1_HUMAN Endonuclease 8-like 1 (Gene Name=NEIL1)

[Back to BioLiP]