Structure of PDB 5iqo Chain C Binding Site BS02

Receptor Information
>5iqo Chain C (length=132) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVT
ASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQS
AHFPLQVRALTVNGGATQGTIEAVIEITYTYS
Ligand information
>5iqo Chain D (length=13) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADSRIRIRGYVRN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5iqo Accelerating the Association of the Most Stable Protein-Ligand Complex by More than Two Orders of Magnitude.
Resolution1.302 Å
Binding residue
(original residue number in PDB)		T20 T21 N22 A23 T24 V25 D26 L27 G28 D29 L30 Y31 S32 T129 Q130 G131 I133 E134 A135 V136 I137 E138 I139 T140 Y141
Binding residue
(residue number reindexed from 1)		T8 T9 N10 A11 T12 V13 D14 L15 G16 D17 L18 Y19 S20 T117 Q118 G119 I121 E122 A123 V124 I125 E126 I127 T128 Y129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007155 cell adhesion
GO:0007638 mechanosensory behavior
GO:0031589 cell-substrate adhesion
GO:0043709 cell adhesion involved in single-species biofilm formation
Cellular Component
GO:0009289 pilus
GO:0009419 pilus tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5iqo, PDBe:5iqo, PDBj:5iqo
PDBsum5iqo
PubMed27351462
UniProtP08190|FIMG_ECOLI Protein FimG (Gene Name=fimG)

[Back to BioLiP]