Structure of PDB 5huy Chain C Binding Site BS02

Receptor Information
>5huy Chain C (length=423) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKF
VSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP
HAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACG
YLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWA
ISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGT
DEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV
NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEP
LMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE
ALQRHENESVYKASLNLIEKYFS
Ligand information
>5huy Chain A (length=9) Species: 311339 (Human herpesvirus 5 strain Toledo) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ATRKRPRRA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5huy Divergent Evolution of Nuclear Localization Signal Sequences in Herpesvirus Terminase Subunits.
Resolution1.979 Å
Binding residue
(original residue number in PDB)
S105 W142 N146 S149 G150 T155 Q181 W184 N188 G191 D192 N228 W231 S234 N235 R238 Y277
Binding residue
(residue number reindexed from 1)
S31 W68 N72 S75 G76 T81 Q107 W110 N114 G117 D118 N154 W157 S160 N161 R164 Y203
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0061608 nuclear import signal receptor activity
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0006606 protein import into nucleus
GO:0015031 protein transport
GO:0075506 entry of viral genome into host nucleus through nuclear pore complex via importin
GO:0099527 postsynapse to nucleus signaling pathway
GO:1903902 positive regulation of viral life cycle
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule
GO:0014069 postsynaptic density
GO:0042564 NLS-dependent protein nuclear import complex
GO:0043657 host cell
GO:0098978 glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5huy, PDBe:5huy, PDBj:5huy
PDBsum5huy
PubMed27033706
UniProtP52293|IMA1_MOUSE Importin subunit alpha-1 (Gene Name=Kpna2)

[Back to BioLiP]