Structure of PDB 5h9e Chain C Binding Site BS02

Receptor Information
>5h9e Chain C (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEIDAMALYRAWQQLDNGSCAQIRRVSEPDELRDIPAFYRLVQPFGWENP
RHQQALLRMVFCLSAGKNVIRHQDKKTGISLGRALANSGRINERRIFQLI
RADRTADMVQLRRLLTHAEPVLDWPLMARMLTWWGKRERQQLLEDFVLTT
Ligand information
>5h9e Chain N (length=40) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctgttggcaagccaggatctgaacaataccgtcatcgagc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5h9e Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
Resolution3.21 Å
Binding residue
(original residue number in PDB)		N19 G20 A23 R26 R101 H123
Binding residue
(residue number reindexed from 1)		N17 G18 A21 R24 R95 H117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0051607 defense response to virus
GO:0099048 CRISPR-cas system
Cellular Component
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5h9e, PDBe:5h9e, PDBj:5h9e
PDBsum5h9e
PubMed26863189
UniProtP76632|CSE2_ECOLI CRISPR system Cascade subunit CasB (Gene Name=casB)

[Back to BioLiP]